Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp872 Rabbit Polyclonal Antibody (HRP)

Zfp872 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

9530015I07Rik

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CHSEHTQWESHGFRGKLYQCKDCGKAFSFQSSFRIHERTHTGEKPYMCKE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001028985

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ANKRD20A2P activation kit by CRISPRa
GA118506 1 Kit

Human ANKRD20A2P activation kit by CRISPRa

Sign In for Pricing
View Details
PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2715), CF405S conjugate, 0.1mg/mL
BNC042715-100 1x 100 µL

PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2715), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DMAC2 (NM_001167870) Human Over-expression Lysate
LY432605 100 µg

DMAC2 (NM_001167870) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Cyp7b1 activation kit by CRISPRa
GA201004 1 Kit

Mouse Cyp7b1 activation kit by CRISPRa

Sign In for Pricing
View Details
Polystyrene A CHO
HA40045006.5G 5 g

Polystyrene A CHO

Sign In for Pricing
View Details
Trpc6 Mouse Gene Knockout Kit (CRISPR)
KN318295LP 1 Kit

Trpc6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details