Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp872 Rabbit Polyclonal Antibody (HRP)

Zfp872 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

9530015I07Rik

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CHSEHTQWESHGFRGKLYQCKDCGKAFSFQSSFRIHERTHTGEKPYMCKE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001028985

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TP73-AS1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A9]
TA503634AM 100 µL

TP73-AS1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A9]

Sign In for Pricing
View Details
RFPL3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B6]
TA504732AM 100 µL

RFPL3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B6]

Sign In for Pricing
View Details
CF®680, Succinimidyl Ester
#92139 1x 1 µmol

CF®680, Succinimidyl Ester

Sign In for Pricing
View Details
ASC 67131
TRC-A101260-1G 1 g

ASC 67131

Sign In for Pricing
View Details
Polystyrene AM RAM
H16020023.25G 25 g

Polystyrene AM RAM

Sign In for Pricing
View Details
AASDH (NM_181806) Human Recombinant Protein
TP316923L 1 mg

AASDH (NM_181806) Human Recombinant Protein

Sign In for Pricing
View Details