Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF845 Rabbit Polyclonal Antibody (HRP)

ZNF845 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LOC91664

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YKCNECGKTFGRNSALIIHKAIHTGEKPYKCNECGKAFSQKSSLTCHLRL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

125kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

NCBI Accession Number

XP_942705

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF2H2C Rabbit pAb
E2505239 100 µL

GTF2H2C Rabbit pAb

Sign In for Pricing
View Details
Smooth Muscle Actin Rabbit Monoclonal Antibody
orb2989844-01 30 µL

Smooth Muscle Actin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Smooth Muscle Actin Rabbit Monoclonal Antibody
orb2989844-02 50 µL

Smooth Muscle Actin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Smooth Muscle Actin Rabbit Monoclonal Antibody
orb2989844-03 100 µL

Smooth Muscle Actin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Smooth Muscle Actin Rabbit Monoclonal Antibody
orb2989844-04 200 µL

Smooth Muscle Actin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CD45 Recombinant Antibody, APC Conjugated
bsm-54757R-APC-01 20 µL

CD45 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details