Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBED9 Rabbit Polyclonal Antibody (HRP)

ZBED9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SCAND3, ZNF452, Buster4, ZFP38-L, ZNF305P2, dJ1186N24.3

UniProt

Q6R2W3

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of human ZNF452

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EAVSRVFPALAGQAPEEQGEIIKVKVKEEDHTWDQESALRRNLSYTRELS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

152kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine

Tested Applications

WB

NCBI Accession Number

NP_443155

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Th Mouse Gene Knockout Kit (CRISPR)
KN517507 1 Kit

Th Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(R)-2-Bromosuccinic Acid
TRC-B688805-2.5G 2.5 g

(R)-2-Bromosuccinic Acid

Sign In for Pricing
View Details
CD80 (B7-1) (C80/2725), CF594 conjugate, 0.1mg/mL
BNC942725-100 1x 100 µL

CD80 (B7-1) (C80/2725), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (T-Helper/Inducer Cell Marker) (CD4/3026), CF568 conjugate, 0.1mg/mL
BNC683026-100 1x 100 µL

CD4 (T-Helper/Inducer Cell Marker) (CD4/3026), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-(5-Fluoropentyl)-1H-indole-3-carboxylic Acid
TRC-F143275-50MG 50 mg

1-(5-Fluoropentyl)-1H-indole-3-carboxylic Acid

Sign In for Pricing
View Details
BTBD10 Mouse Monoclonal Antibody [Clone ID: OTI7D3]
CF808404 100 µg

BTBD10 Mouse Monoclonal Antibody [Clone ID: OTI7D3]

Sign In for Pricing
View Details