Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOHLH1 Rabbit Polyclonal Antibody (Biotin)

SOHLH1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ODG5, TEB2, NOHLH, SPGF32, SPATA27, bHLHe80, C9orf157, bA100C15.3

UniProt

Q5JUK2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SOHLH1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MGAAPLGEPAKEDPMLAQEAGSALGSDVDDGTSFLLTAGPSSWPGEWGPG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-SCCPDH Antibody
YLD7011-01 50 µL

Rabbit anti-SCCPDH Antibody

Sign In for Pricing
View Details
Rabbit anti-SCCPDH Antibody
YLD7011-02 100 µL

Rabbit anti-SCCPDH Antibody

Sign In for Pricing
View Details
Human GDF-15, His tag
E4A10G03 50 µg

Human GDF-15, His tag

Sign In for Pricing
View Details
PELP1 (Proline-, Glutamic Acid- and Leucine-rich Protein 1, Modulator of Non-genomic Activity of Estrogen Receptor, Transcription Factor HMX3, HMX3, MNAR) (MaxLight 550) discontinued
127969-ML550 100 µL

PELP1 (Proline-, Glutamic Acid- and Leucine-rich Protein 1, Modulator of Non-genomic Activity of Estrogen Receptor, Transcription Factor HMX3, HMX3, MNAR) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Donkey Polyclonal Donkey anti-Human IgG (H+L) Secondary Antibody [Biotin]
NBP1-51847B 1 mL

Donkey Polyclonal Donkey anti-Human IgG (H+L) Secondary Antibody [Biotin]

Sign In for Pricing
View Details
NSC-87877 disodium
BUP10574-01 5 mg

NSC-87877 disodium

Sign In for Pricing
View Details