Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM4 Rabbit Polyclonal Antibody (HRP)

TRIM4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RNF87

UniProt

Q9C037

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LVCRESQEHQTHAMAPIDEAFESYRTGNFDIHVDEWKRRLIRLLLYHSKQ

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_148977

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASMEPM-50X345MM-SODIUM HYDROXIDE Pipe Markers for Acids & Bases
313188 2 Card (2 Marker (s) x 1 Pack)

ASMEPM-50X345MM-SODIUM HYDROXIDE Pipe Markers for Acids & Bases

Sign In for Pricing
View Details
P21 Protein Activated Kinase 4 Phospho-Ser474 (PAK4 pS474) Antibody
abx328530-01 50 µg

P21 Protein Activated Kinase 4 Phospho-Ser474 (PAK4 pS474) Antibody

Sign In for Pricing
View Details
P21 Protein Activated Kinase 4 Phospho-Ser474 (PAK4 pS474) Antibody
abx328530-02 100 µg

P21 Protein Activated Kinase 4 Phospho-Ser474 (PAK4 pS474) Antibody

Sign In for Pricing
View Details
RHOXF2 Human shRNA Plasmid Kit (Locus ID 84528)
TL307385 1 Kit

RHOXF2 Human shRNA Plasmid Kit (Locus ID 84528)

Sign In for Pricing
View Details
Canine Growth Factor Receptor Bound Protein 2 ELISA Kit
MBS735446-01 48 Well

Canine Growth Factor Receptor Bound Protein 2 ELISA Kit

Sign In for Pricing
View Details
Canine Growth Factor Receptor Bound Protein 2 ELISA Kit
MBS735446-02 96 Well

Canine Growth Factor Receptor Bound Protein 2 ELISA Kit

Sign In for Pricing
View Details