Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sohlh1 Rabbit Polyclonal Antibody (HRP)

Sohlh1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gm110, Nohlh, RP23-123F7.2

UniProt

Q6IUP1

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PQEMWHMWQGDVLQVTLANQIADSKPDSGIAKPSAVSRVQDPPCFGMLDT

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001001714

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 350-Wheat Germ Agglutinin (WGA) Conjugate
25525-AAT 1 mg

IFluor® 350-Wheat Germ Agglutinin (WGA) Conjugate

Sign In for Pricing
View Details
Endoglin / CD105 (ENG/1621), CF740 conjugate, 0.1mg/mL
BNC741621-100 1x 100 µL

Endoglin / CD105 (ENG/1621), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti Human ORC5L Polyclonal
Y055492 100 µL

Anti Human ORC5L Polyclonal

Sign In for Pricing
View Details
Phospho-PARP1 Antibody (pS864)
F48731-0.4ML 0.4 mL

Phospho-PARP1 Antibody (pS864)

Sign In for Pricing
View Details
VC Lambda / Pst I Marker (ready-to-use), 5 x 50µg
NM2428 5 x 50μg

VC Lambda / Pst I Marker (ready-to-use), 5 x 50µg

Sign In for Pricing
View Details
Recombinant Mouse Fetuin-B/FETUB Protein (His Tag)
PKSM040606 100 µg

Recombinant Mouse Fetuin-B/FETUB Protein (His Tag)

Sign In for Pricing
View Details