Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrxl1 Rabbit Polyclonal Antibody (Biotin)

Prrxl1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Drg1, Drgx, Drg11

UniProt

Q8BYH0

Immunogen

The immunogen is a synthetic peptide directed towards the c terminal region of mouse Prrxl1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PSCLPGTLLNTATYAQALSHVASLKDHFRAMLCSGSFGFRGEQTQQRALT

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001001796

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crabp2 ORF Vector (Rat) (pORF)
16798016 1.0 µg DNA

Crabp2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Lentiviral human UBAP1 shRNA (UAS) - Lentiviral human UBAP1 shRNA (UAS) (25)
GTR15326588 1 Vial

Lentiviral human UBAP1 shRNA (UAS) - Lentiviral human UBAP1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Rat Hyaluronan Mediated Motility Receptor ELISA Kit
MBS069305-01 48 Well

Rat Hyaluronan Mediated Motility Receptor ELISA Kit

Sign In for Pricing
View Details
Rat Hyaluronan Mediated Motility Receptor ELISA Kit
MBS069305-02 96 Well

Rat Hyaluronan Mediated Motility Receptor ELISA Kit

Sign In for Pricing
View Details
Rat Hyaluronan Mediated Motility Receptor ELISA Kit
MBS069305-03 5x 96 Well

Rat Hyaluronan Mediated Motility Receptor ELISA Kit

Sign In for Pricing
View Details
Rat Hyaluronan Mediated Motility Receptor ELISA Kit
MBS069305-04 10x 96 Well

Rat Hyaluronan Mediated Motility Receptor ELISA Kit

Sign In for Pricing
View Details