Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrxl1 Rabbit Polyclonal Antibody (HRP)

Prrxl1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Drg1, Drgx, Drg11

UniProt

Q8BYH0

Immunogen

The immunogen is a synthetic peptide directed towards the c terminal region of mouse Prrxl1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PSCLPGTLLNTATYAQALSHVASLKDHFRAMLCSGSFGFRGEQTQQRALT

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001001796

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11b / MAC-1 (Microglial Marker) (ITGAM/3340), CF405S conjugate, 0.1mg/mL
BNC043340-500 1x 500 µL

CD11b / MAC-1 (Microglial Marker) (ITGAM/3340), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Smc5 Mouse Gene Knockout Kit (CRISPR)
KN516299 1 Kit

Smc5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Replacement cap, standard blue (GL45), 10/pk.
B3000-CAP* 1 Each

Replacement cap, standard blue (GL45), 10/pk.

Sign In for Pricing
View Details
Tmem269 Mouse Gene Knockout Kit (CRISPR)
KN500391 1 Kit

Tmem269 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Camfetamine Hydrochloride
TRC-C150050-5MG 5 mg

Camfetamine Hydrochloride

Sign In for Pricing
View Details
WIPI2 (NM_001033520) Human Over-expression Lysate
LC422379 20 µg

WIPI2 (NM_001033520) Human Over-expression Lysate

Sign In for Pricing
View Details