Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALX3 Rabbit Polyclonal Antibody (Biotin)

ALX3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

O70137

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse ALX3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MDPERCAPFSVGPAAGPYAAAGDEAPGPQGTPDAAPHLHPAPPRGPRLSR

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_031467

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAZAP1 Rabbit Polyclonal Antibody (Cy3)
orb2609401 100 µg

DAZAP1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
PE Anti-Mouse CD272/BTLA Antibody[PK18.6]
E-AB-F1024UD-01 25 µg

PE Anti-Mouse CD272/BTLA Antibody[PK18.6]

Sign In for Pricing
View Details
PE Anti-Mouse CD272/BTLA Antibody[PK18.6]
E-AB-F1024UD-02 100 µg

PE Anti-Mouse CD272/BTLA Antibody[PK18.6]

Sign In for Pricing
View Details
Nori® Zebrafish BMP1 ELISA Kit
GR206005 96 Well

Nori® Zebrafish BMP1 ELISA Kit

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Metallothionein-like protein 4C (MT4C)
MBS1433083-01 0.02 mg (E-Coli)

Recombinant Oryza sativa subsp. japonica Metallothionein-like protein 4C (MT4C)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Metallothionein-like protein 4C (MT4C)
MBS1433083-02 0.1 mg (E-Coli)

Recombinant Oryza sativa subsp. japonica Metallothionein-like protein 4C (MT4C)

Sign In for Pricing
View Details