Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALX3 Rabbit Polyclonal Antibody (HRP)

ALX3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O70137

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse ALX3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDPERCAPFSVGPAAGPYAAAGDEAPGPQGTPDAAPHLHPAPPRGPRLSR

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_031467

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM24, NT (TRIM24, RNF82, TIF1, TIF1A, Transcription intermediary factor 1-alpha, E3 ubiquitin-protein ligase TRIM24, RING finger protein 82, Tripartite motif-containing protein 24) (MaxLight 490) discontinued
043220-ML490 100 µL

TRIM24, NT (TRIM24, RNF82, TIF1, TIF1A, Transcription intermediary factor 1-alpha, E3 ubiquitin-protein ligase TRIM24, RING finger protein 82, Tripartite motif-containing protein 24) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Acot10 Protein Vector (Mouse) (pPM-C-His)
PV151781 500 ng

Acot10 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
C21orf58 discontinued
507479 100 µg

C21orf58 discontinued

Sign In for Pricing
View Details
Rabbit Anti-Human MAP-4 Polyclonal Antibody
PA89663HU-01 50 µg

Rabbit Anti-Human MAP-4 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human MAP-4 Polyclonal Antibody
PA89663HU-02 100 µg

Rabbit Anti-Human MAP-4 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human MAP-4 Polyclonal Antibody
PA89663HU-03 500 µg

Rabbit Anti-Human MAP-4 Polyclonal Antibody

Sign In for Pricing
View Details