Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxj1 Rabbit Polyclonal Antibody (FITC)

Foxj1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Hfh4, HFH-4, FKHL-1, FKHL-13

UniProt

Q3US42

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YAERLLSGAFKKRRLPPVHIHPAFARQASQEPSAAPWGGPLTVNREAQQL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032266

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human 4-1BB/TNFRSF9 Alexa Fluor 488 MAb (Clone 2356B)
FAB8381G-100UG 100 µg

Human 4-1BB/TNFRSF9 Alexa Fluor 488 MAb (Clone 2356B)

Sign In for Pricing
View Details
Mitogen Activated Protein Kinase 14 (MAPK14) BioAssayTM ELISA Kit (Human)
026843-01 48 Tests

Mitogen Activated Protein Kinase 14 (MAPK14) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Mitogen Activated Protein Kinase 14 (MAPK14) BioAssayTM ELISA Kit (Human)
026843-02 96 Tests

Mitogen Activated Protein Kinase 14 (MAPK14) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Recombinant Sodalis glossinidius Deoxycytidine triphosphate deaminase (dcd)
MBS1323987-01 0.02 mg (E-Coli)

Recombinant Sodalis glossinidius Deoxycytidine triphosphate deaminase (dcd)

Sign In for Pricing
View Details
Recombinant Sodalis glossinidius Deoxycytidine triphosphate deaminase (dcd)
MBS1323987-02 0.1 mg (E-Coli)

Recombinant Sodalis glossinidius Deoxycytidine triphosphate deaminase (dcd)

Sign In for Pricing
View Details
Recombinant Sodalis glossinidius Deoxycytidine triphosphate deaminase (dcd)
MBS1323987-03 0.02 mg (Yeast)

Recombinant Sodalis glossinidius Deoxycytidine triphosphate deaminase (dcd)

Sign In for Pricing
View Details