Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Npas2 Rabbit Polyclonal Antibody (HRP)

Npas2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MO, MOP4, bHLHe, bHLHe9

UniProt

P97460

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human Npas2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PSPQRLDLDKASKKFPGSLPCQAGSAEPAGAGAGAPAAMLSDADAGDTFG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

91kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032745

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ACAD11 sgRNA gene knockout kit - Lentiviral human ACAD11 sgRNA gene knockout kit (plasmid)
GTR15366632 1 Vial

Lentiviral human ACAD11 sgRNA gene knockout kit - Lentiviral human ACAD11 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
TAS1R3 Antibody
MBS7121005-01 0.05 mg

TAS1R3 Antibody

Sign In for Pricing
View Details
TAS1R3 Antibody
MBS7121005-02 0.1 mg

TAS1R3 Antibody

Sign In for Pricing
View Details
TAS1R3 Antibody
MBS7121005-03 5x 0.1 mg

TAS1R3 Antibody

Sign In for Pricing
View Details
Bcl-2 Antibody Cocktail
V2835-100UG 100 µg

Bcl-2 Antibody Cocktail

Sign In for Pricing
View Details
Lentiviral human RXFP2 sgRNA gene knockout kit - Lentiviral human RXFP2 sgRNA gene knockout kit (plasmid)
GTR15389999 1 Vial

Lentiviral human RXFP2 sgRNA gene knockout kit - Lentiviral human RXFP2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details