Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RELB Rabbit Polyclonal Antibody (Biotin)

RELB Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Sh, shep

UniProt

Q04863

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse RELB

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MPSRRAARESAPELGALGSSDLSSLSLTVSRTTDELEIIDEYIKENGFGL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_033072

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SB431542 Solution (100 mM)
PB180611 0.1 mL

SB431542 Solution (100 mM)

Sign In for Pricing
View Details
SCN5A Protein Vector (Human) (pPB-N-His)
PV128219 500 ng

SCN5A Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Anti-Human Perilipin A DyLight® 488 conjugated PLIN1 Antibody, Carrier-free
A03918-Dyl488-carrier-free 100 µg

Anti-Human Perilipin A DyLight® 488 conjugated PLIN1 Antibody, Carrier-free

Sign In for Pricing
View Details
TRK B Rabbit monoclonal antibody
MB66249-01 50 µL

TRK B Rabbit monoclonal antibody

Sign In for Pricing
View Details
TRK B Rabbit monoclonal antibody
MB66249-02 100 µL

TRK B Rabbit monoclonal antibody

Sign In for Pricing
View Details
CD19 Rabbit Polyclonal Antibody (HRP)
orb2619044 100 µg

CD19 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details