Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrx2 Rabbit Polyclonal Antibody (HRP)

Prrx2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S, Pr, S8, Prx2

UniProt

Q06348

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AKFRRNERAMLATRSASLLKSYGQEAAIEQPVAPRPTTMSPDYLSWPASS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033142

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-D-Ile TentaGel® S AC Resin
SAD1115.1G 1 g

Fmoc-D-Ile TentaGel® S AC Resin

Sign In for Pricing
View Details
P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF594 conjugate, 0.1mg/mL
BNC941786-100 1x 100 µL

P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (HSPB1/774), Biotin conjugate, 0.1mg/mL
BNCB0774-100 1x 100 µL

HSP27 (HSPB1/774), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/3219R), CF647 conjugate, 0.1mg/mL
BNC473219-500 1x 500 µL

Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/3219R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD73 (Immuno-Oncology Target) (NT5E/2545), 1mg/mL
BNUM2545-50 1x 50 µL

CD73 (Immuno-Oncology Target) (NT5E/2545), 1mg/mL

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), CF594 conjugate, 0.1mg/mL
BNC942053-500 1x 500 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details