Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR1I3 Rabbit Polyclonal Antibody (Biotin)

NR1I3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C, CA, mC, CAR, MB67, Care2, ESTM3, ESTM32, AA209988, AI551208, CAR-beta

UniProt

O35627

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse NR1I3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KELVQILLGAHTRHVGPLFDQFVQFKPPAYLFMHHRPFQPRGPVLPLLTH

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_033933

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TBL1Y activation kit by CRISPRa
GA114049 1 Kit

Human TBL1Y activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS715648 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
General Purpose Incubator BIGP-6501
BIGP-6501 1 Unit

General Purpose Incubator BIGP-6501

Sign In for Pricing
View Details
Recombinant Human Beta-2-Microglobulin/B2M Protein (HEK293 Cells, His Tag)
PKSH030949-01 100 µg

Recombinant Human Beta-2-Microglobulin/B2M Protein (HEK293 Cells, His Tag)

Sign In for Pricing
View Details
Recombinant Human Beta-2-Microglobulin/B2M Protein (HEK293 Cells, His Tag)
PKSH030949-02 1 mg

Recombinant Human Beta-2-Microglobulin/B2M Protein (HEK293 Cells, His Tag)

Sign In for Pricing
View Details
BIRC5 Human Gene Knockout Kit (CRISPR)
KN205935BN 1 Kit

BIRC5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details