Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR1I3 Rabbit Polyclonal Antibody (FITC)

NR1I3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C, CA, mC, CAR, MB67, Care2, ESTM3, ESTM32, AA209988, AI551208, CAR-beta

UniProt

O35627

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse NR1I3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KELVQILLGAHTRHVGPLFDQFVQFKPPAYLFMHHRPFQPRGPVLPLLTH

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_033933

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Apobec 1 Complementation Factor ELISA Kit
MBS747133-01 48 Well

Sheep Apobec 1 Complementation Factor ELISA Kit

Sign In for Pricing
View Details
Sheep Apobec 1 Complementation Factor ELISA Kit
MBS747133-02 96 Well

Sheep Apobec 1 Complementation Factor ELISA Kit

Sign In for Pricing
View Details
Sheep Apobec 1 Complementation Factor ELISA Kit
MBS747133-03 5x 96 Well

Sheep Apobec 1 Complementation Factor ELISA Kit

Sign In for Pricing
View Details
Sheep Apobec 1 Complementation Factor ELISA Kit
MBS747133-04 10x 96 Well

Sheep Apobec 1 Complementation Factor ELISA Kit

Sign In for Pricing
View Details
Cytokeratin, Basic (KRT, Type II, HMW) (AP) discontinued
172082-AF-AP 100 µL

Cytokeratin, Basic (KRT, Type II, HMW) (AP) discontinued

Sign In for Pricing
View Details
TPO Rabbit pAb
MBS8540009-01 0.1 mL

TPO Rabbit pAb

Sign In for Pricing
View Details