Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Runx1 Rabbit Polyclonal Antibody (HRP)

Runx1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AM, AML1, Cbfa, Pebp, Cbfa2, Pebp2a2, Pebpa2b, CBF-alpha-2

UniProt

Q03347

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Runx1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KMSEALPLGAPDGGPALASKLRSGDRSMVEVLADHPGELVRTDSPNFLCS

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033951

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHAD, GST-Tag, Recombinant (SLRR4A, Chondroadherin) discontinued
500661 200 µg

CHAD, GST-Tag, Recombinant (SLRR4A, Chondroadherin) discontinued

Sign In for Pricing
View Details
ZDHHC7 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-12088R-BF350-TR 20 µL

ZDHHC7 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Anti-ADAR2 (R510) ADARB1 Antibody
A01810-1 100 µL

Anti-ADAR2 (R510) ADARB1 Antibody

Sign In for Pricing
View Details
Anti-AURKA (P282) Antibody
A00246 100 µL

Anti-AURKA (P282) Antibody

Sign In for Pricing
View Details
CEACAM-3/CD66d Fc Chimera Protein, Human
UA010277-01 25 µg

CEACAM-3/CD66d Fc Chimera Protein, Human

Sign In for Pricing
View Details
CEACAM-3/CD66d Fc Chimera Protein, Human
UA010277-02 100 µg

CEACAM-3/CD66d Fc Chimera Protein, Human

Sign In for Pricing
View Details