Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXD3 Rabbit Polyclonal Antibody (FITC)

HOXD3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Hox-4., Hox-5., Hox-4.1, Hox-5.5

UniProt

P09027

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse HOXD3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NLQGSPVYVGGNFVDSMAPTSGPVFNLGHLSHPSSASVDYSCAAQIPGNH

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034598

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trim7 Mouse Gene Knockout Kit (CRISPR)
KN518238 1 Kit

Trim7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Aminophenyl b-GlcNAc Gel
CG-029-5 5 mL

Aminophenyl b-GlcNAc Gel

Sign In for Pricing
View Details
Uncoated Mouse IL-1α (Interleukin 1 Alpha) ELISA Kit
E-UNEL-M0031-01 5x 96 Tests

Uncoated Mouse IL-1α (Interleukin 1 Alpha) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse IL-1α (Interleukin 1 Alpha) ELISA Kit
E-UNEL-M0031-02 15x 96 Tests

Uncoated Mouse IL-1α (Interleukin 1 Alpha) ELISA Kit

Sign In for Pricing
View Details
Horn, 3mm diameter, for 3-10ml, fits DP0150
DP0150-3 1 Each

Horn, 3mm diameter, for 3-10ml, fits DP0150

Sign In for Pricing
View Details
MAD1 (MAD1L1) (NM_001013836) Human Over-expression Lysate
LY423037 100 µg

MAD1 (MAD1L1) (NM_001013836) Human Over-expression Lysate

Sign In for Pricing
View Details