Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXD3 Rabbit Polyclonal Antibody (HRP)

HOXD3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hox-4., Hox-5., Hox-4.1, Hox-5.5

UniProt

P09027

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse HOXD3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NLQGSPVYVGGNFVDSMAPTSGPVFNLGHLSHPSSASVDYSCAAQIPGNH

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034598

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5,3',4'-Trihydroxyflavone (>85%)
TRC-T896685-50MG 50 mg

5,3',4'-Trihydroxyflavone (>85%)

Sign In for Pricing
View Details
E2F3 Rabbit Polyclonal Antibody
TA367560 100 µL

E2F3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse Cathepsin E/CTSE Protein (aa 1-397, His Tag)
PKSM040613 50 µg

Recombinant Mouse Cathepsin E/CTSE Protein (aa 1-397, His Tag)

Sign In for Pricing
View Details
Texas Red Conjugated Rabbit Anti-Con A Antibody
TAL-1104-2 2 mL

Texas Red Conjugated Rabbit Anti-Con A Antibody

Sign In for Pricing
View Details
Mouse Esrrg activation kit by CRISPRa
GA204934 1 Kit

Mouse Esrrg activation kit by CRISPRa

Sign In for Pricing
View Details
CD53 (161-2), CF647 conjugate, 0.1mg/mL
BNC470324-100 1x 100 µL

CD53 (161-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details