Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPARD Rabbit Polyclonal Antibody (FITC)

PPARD Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P, NUC, Nr1, Ppa, NUC1, PPAR, NUC-1, Nr1c2, Pparb, PPAR[b], Pparb/d, PPAR-beta, PPARdelta, PPAR-delta

UniProt

P35396

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse PPARD

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FGRMPEAEKRKLVAGLTASEGCQHNPQLADLKAFSKHIYNAYLKNFNMTK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035275

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCAPH2 Peptide - N-terminal region
orb2013017 100 µg

NCAPH2 Peptide - N-terminal region

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Mucin 2 (MUC2)
MBS2046367-01 0.1 mL

APC-Linked Polyclonal Antibody to Mucin 2 (MUC2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Mucin 2 (MUC2)
MBS2046367-02 0.2 mL

APC-Linked Polyclonal Antibody to Mucin 2 (MUC2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Mucin 2 (MUC2)
MBS2046367-03 0.5 mL

APC-Linked Polyclonal Antibody to Mucin 2 (MUC2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Mucin 2 (MUC2)
MBS2046367-04 1 mL

APC-Linked Polyclonal Antibody to Mucin 2 (MUC2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Mucin 2 (MUC2)
MBS2046367-05 5 mL

APC-Linked Polyclonal Antibody to Mucin 2 (MUC2)

Sign In for Pricing
View Details