Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPARD Rabbit Polyclonal Antibody (HRP)

PPARD Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P, NUC, Nr1, Ppa, NUC1, PPAR, NUC-1, Nr1c2, Pparb, PPAR[b], Pparb/d, PPAR-beta, PPARdelta, PPAR-delta

UniProt

P35396

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse PPARD

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGRMPEAEKRKLVAGLTASEGCQHNPQLADLKAFSKHIYNAYLKNFNMTK

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035275

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig CCL1 (Chemokine C-C-Motif Ligand 1) ELISA Kit
MBS2506604-01 24 Tests

Guinea pig CCL1 (Chemokine C-C-Motif Ligand 1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig CCL1 (Chemokine C-C-Motif Ligand 1) ELISA Kit
MBS2506604-02 48 Tests

Guinea pig CCL1 (Chemokine C-C-Motif Ligand 1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig CCL1 (Chemokine C-C-Motif Ligand 1) ELISA Kit
MBS2506604-03 96 Tests

Guinea pig CCL1 (Chemokine C-C-Motif Ligand 1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig CCL1 (Chemokine C-C-Motif Ligand 1) ELISA Kit
MBS2506604-04 5x 96 Tests

Guinea pig CCL1 (Chemokine C-C-Motif Ligand 1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig CCL1 (Chemokine C-C-Motif Ligand 1) ELISA Kit
MBS2506604-05 10x 96 Tests

Guinea pig CCL1 (Chemokine C-C-Motif Ligand 1) ELISA Kit

Sign In for Pricing
View Details
RHOC, CT (RHOC, ARH9, ARHC, Rho-related GTP-binding protein RhoC, Rho cDNA clone 9) (MaxLight 490)
MBS6341945-01 0.1 mL

RHOC, CT (RHOC, ARH9, ARHC, Rho-related GTP-binding protein RhoC, Rho cDNA clone 9) (MaxLight 490)

Sign In for Pricing
View Details