Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFPI1 Rabbit Polyclonal Antibody (Biotin)

SFPI1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Sf, Sp, Dis, PU., Sfp, Dis1, PU.1, Dis-1, Sfpi1, Spi-1, Tcfpu, Tfpu., Sfpi-1, Tcfpu1, Tfpu.1

UniProt

P17433

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse SFPI1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NEFENFPENHFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHTGLSH

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_035485

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rc3h2 Mouse qPCR Primer Pair (NM_001100591)
MP219260 200 Reactions

Rc3h2 Mouse qPCR Primer Pair (NM_001100591)

Sign In for Pricing
View Details
Recombinant Human ADP-ribosylation factor-like protein 1, GST, E.coli-50ug
QP8213-ec-50ug 50ug

Recombinant Human ADP-ribosylation factor-like protein 1, GST, E.coli-50ug

Sign In for Pricing
View Details
Human SDR9C7 siRNA
abx932740-01 15 nmol

Human SDR9C7 siRNA

Sign In for Pricing
View Details
Human SDR9C7 siRNA
abx932740-02 30 nmol

Human SDR9C7 siRNA

Sign In for Pricing
View Details
Sodium 5-chloro-2-fluorobenzoate
PC49060 1 g

Sodium 5-chloro-2-fluorobenzoate

Sign In for Pricing
View Details
CA12 Antibody Biotin Conjugate
R35918BTN 100 µg

CA12 Antibody Biotin Conjugate

Sign In for Pricing
View Details