Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPIC Rabbit Polyclonal Antibody (Biotin)

SPIC Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P, Sp, Prf, Spi-C, C76795, AU019198

UniProt

Q6P3D7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse SPIC

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MTCCIDQDSLGQTFQDAIDILIQQSAGESQYSSENRNYMAIINPYPHVRG

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse

Tested Applications

WB

NCBI Accession Number

NP_035591

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Anti-smooth muscle Myosin heavy chain 11 antibody (Mouse mAb)
GB151220-100 100 μL

Recombinant Anti-smooth muscle Myosin heavy chain 11 antibody (Mouse mAb)

Sign In for Pricing
View Details
ZNF454, NT (ZNF454, Zinc finger protein 454) (MaxLight 550)
MBS6366675-01 0.1 mL

ZNF454, NT (ZNF454, Zinc finger protein 454) (MaxLight 550)

Sign In for Pricing
View Details
ZNF454, NT (ZNF454, Zinc finger protein 454) (MaxLight 550)
MBS6366675-02 5x 0.1 mL

ZNF454, NT (ZNF454, Zinc finger protein 454) (MaxLight 550)

Sign In for Pricing
View Details
Tissue, Section, Human Tumor, Brain Tumor, Astrocytoma Grade III (Paraffin)
MBS640153-01 5 Sections

Tissue, Section, Human Tumor, Brain Tumor, Astrocytoma Grade III (Paraffin)

Sign In for Pricing
View Details
Tissue, Section, Human Tumor, Brain Tumor, Astrocytoma Grade III (Paraffin)
MBS640153-02 5x 5 Sections

Tissue, Section, Human Tumor, Brain Tumor, Astrocytoma Grade III (Paraffin)

Sign In for Pricing
View Details
PKM2 (Pyruvate Kinase, Tumor Type M2, Pyruvate Kinase, Isozymes M1/M2, Pyruvate Kinase Muscle Isozyme, TCB, PK3, PKM2 Pyruvate Kinase, Muscle, CTHBP, PK2) discontinued
212631-01 50 µL

PKM2 (Pyruvate Kinase, Tumor Type M2, Pyruvate Kinase, Isozymes M1/M2, Pyruvate Kinase Muscle Isozyme, TCB, PK3, PKM2 Pyruvate Kinase, Muscle, CTHBP, PK2) discontinued

Sign In for Pricing
View Details