Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nr2c1 Rabbit Polyclonal Antibody (FITC)

Nr2c1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ee, TR, TR2, 80.3, Eenr, Tr2-1, Tr2-11, 4831444H07Rik

UniProt

Q505F1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of MOUSE Nr2c1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GSTPGKVFLTTPDAAGVNQLFFTSPDLSAPHLQLLTEKSPDQGPNKVFDL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Kanamycin (KNM)
TRV-0061430-01 20 µL

Monoclonal Antibody to Kanamycin (KNM)

Sign In for Pricing
View Details
Monoclonal Antibody to Kanamycin (KNM)
TRV-0061430-02 100 µL

Monoclonal Antibody to Kanamycin (KNM)

Sign In for Pricing
View Details
Monoclonal Antibody to Kanamycin (KNM)
TRV-0061430-03 200 µL

Monoclonal Antibody to Kanamycin (KNM)

Sign In for Pricing
View Details
Monoclonal Antibody to Kanamycin (KNM)
TRV-0061430-04 1 mL

Monoclonal Antibody to Kanamycin (KNM)

Sign In for Pricing
View Details
Mouse Monoclonal AKT1 Antibody (302407) [Janelia Fluor 669]
FAB17751JF669 0.1 mL

Mouse Monoclonal AKT1 Antibody (302407) [Janelia Fluor 669]

Sign In for Pricing
View Details
Upk3bl (Upk3bl1) (NM_001109020) Rat Tagged Lenti ORF Clone
RR203768L3 10 µg

Upk3bl (Upk3bl1) (NM_001109020) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details