Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trp53 Rabbit Polyclonal Antibody (Biotin)

Trp53 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P4, p5, bbl, bfy, bhy, p44, p53, Tp53

UniProt

Q549C9

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EEFFEGPSEALRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTY

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_035770

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Lce1d shRNA (UAS) - Lentiviral mouse Lce1d shRNA (UAS, iRFP) plasmid
GTR15286156 1 Vial

Lentiviral mouse Lce1d shRNA (UAS) - Lentiviral mouse Lce1d shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Grhl1 3'UTR GFP Stable Cell Line
TU159095 1.0 mL

Grhl1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Traj4 activation kit by CRISPRa
GA219215 1 Kit

Mouse Traj4 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Glial Cell Line Derived Neurotrophic Factor (GDNF) ELISA Kit
abx050074-01 96 Tests

Mouse Glial Cell Line Derived Neurotrophic Factor (GDNF) ELISA Kit

Sign In for Pricing
View Details
Mouse Glial Cell Line Derived Neurotrophic Factor (GDNF) ELISA Kit
abx050074-02 5x 96 Tests

Mouse Glial Cell Line Derived Neurotrophic Factor (GDNF) ELISA Kit

Sign In for Pricing
View Details
Mouse Glial Cell Line Derived Neurotrophic Factor (GDNF) ELISA Kit
abx050074-03 10x 96 Tests

Mouse Glial Cell Line Derived Neurotrophic Factor (GDNF) ELISA Kit

Sign In for Pricing
View Details