Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trp53 Rabbit Polyclonal Antibody (Biotin)

Trp53 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P4, p5, bbl, bfy, bhy, p44, p53, Tp53

UniProt

Q549C9

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EEFFEGPSEALRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTY

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_035770

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIAS1, CT E3 SUMO-protein Ligase PIAS1, Protein Inhibitor of Activated STAT Protein 1, Gu Binding Protein, GBP, RNA Helicase II Binding Protein, DEAD/H Box-binding Protein 1, DDXBP1) (FITC) discontinued
P4086-01A-FITC 200 µL

PIAS1, CT E3 SUMO-protein Ligase PIAS1, Protein Inhibitor of Activated STAT Protein 1, Gu Binding Protein, GBP, RNA Helicase II Binding Protein, DEAD/H Box-binding Protein 1, DDXBP1) (FITC) discontinued

Sign In for Pricing
View Details
Human LTA (NM_000595) AAV Particle
RC203741A1V 250 µL

Human LTA (NM_000595) AAV Particle

Sign In for Pricing
View Details
Rabbit Polyclonal OBFC2A Antibody [Alexa Fluor 532]
NBP1-26640AF532 0.1 mL

Rabbit Polyclonal OBFC2A Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
Carbonic Anhydrase II (CA2) Antibody
abx033311-01 80 µL

Carbonic Anhydrase II (CA2) Antibody

Sign In for Pricing
View Details
Carbonic Anhydrase II (CA2) Antibody
abx033311-02 400 µL

Carbonic Anhydrase II (CA2) Antibody

Sign In for Pricing
View Details
C3orf56 Protein Vector (Human) (pPB-N-His)
PV066574 500 ng

C3orf56 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details