Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trp53 Rabbit Polyclonal Antibody (HRP)

Trp53 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P4, p5, bbl, bfy, bhy, p44, p53, Tp53

UniProt

Q549C9

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EEFFEGPSEALRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTY

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_035770

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS506687 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/3156R), CF740 conjugate, 0.1mg/mL
BNC743156-500 1x 500 µL

P53 Tumor Suppressor Protein (TP53/3156R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C12orf48 (PARPBP) Human Gene Knockout Kit (CRISPR)
KN420356 1 Kit

C12orf48 (PARPBP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VAV3 (567-578) Goat Polyclonal Antibody
AP22535PU-N 50 µg

VAV3 (567-578) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Human Lambda Light Chain Mouse Monoclonal Antibody [Clone ID: 4C2]
AM12139FC-N 100 Tests

Human Lambda Light Chain Mouse Monoclonal Antibody [Clone ID: 4C2]

Sign In for Pricing
View Details
OR8B12 (C-term) Rabbit Polyclonal Antibody
AP53105PU-N 400 µL

OR8B12 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details