Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mybbp1a Rabbit Polyclonal Antibody (HRP)

Mybbp1a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P160, p67M, p160M, p67MBP, p160MBP, AL024407, AU019902

UniProt

Q7TPV4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse Mybbp1a

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HSSGSNRLYDLYWQAMRMLGVQRPKSEKKNAKDIPSDTQSPVSTKRKKKG

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

152kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_058056

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL-3 Receptor Subunit Alpha/IL-3RA/CD123 (C-6His)
PKSH034052-01 10 µg

Recombinant Human IL-3 Receptor Subunit Alpha/IL-3RA/CD123 (C-6His)

Sign In for Pricing
View Details
Recombinant Human IL-3 Receptor Subunit Alpha/IL-3RA/CD123 (C-6His)
PKSH034052-02 50 µg

Recombinant Human IL-3 Receptor Subunit Alpha/IL-3RA/CD123 (C-6His)

Sign In for Pricing
View Details
GPR182 (NM_007264) Human Over-expression Lysate
LC402121 20 µg

GPR182 (NM_007264) Human Over-expression Lysate

Sign In for Pricing
View Details
SOCS1 (NM_003745) Human Over-expression Lysate
LY401230 100 µg

SOCS1 (NM_003745) Human Over-expression Lysate

Sign In for Pricing
View Details
CD45RA (111-1C5), 0.2mg/mL
BNUB1038-500 1x 500 µL

CD45RA (111-1C5), 0.2mg/mL

Sign In for Pricing
View Details
CD7 Antibody
KC-47219-01 50 μL

CD7 Antibody

Sign In for Pricing
View Details