Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSG101 Rabbit Polyclonal Antibody (FITC)

TSG101 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CC2, AI255943

UniProt

Q61187

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YMPGMPSGISAYPSGYPPNPSGYPGCPYPPAGPYPATTSSQYPSQPPVTT

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_068684

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epstein-Barr Virus (LMP-1) (CS2), CF405S conjugate, 0.1mg/mL
BNC041742-500 1x 500 µL

Epstein-Barr Virus (LMP-1) (CS2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
O-Benzyl Psilocin
TRC-B288710-10MG 10 mg

O-Benzyl Psilocin

Sign In for Pricing
View Details
Chlorguanide-d6 Hydrochloride
TRC-C329503-1MG 1 mg

Chlorguanide-d6 Hydrochloride

Sign In for Pricing
View Details
TRIM49C Human Gene Knockout Kit (CRISPR)
KN430835 1 Kit

TRIM49C Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Human IgA
HAF-002-1 1 mL

Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Human IgA

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometriotic tissue
CS705754 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details