Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSG101 Rabbit Polyclonal Antibody (HRP)

TSG101 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CC2, AI255943

UniProt

Q61187

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YMPGMPSGISAYPSGYPPNPSGYPGCPYPPAGPYPATTSSQYPSQPPVTT

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_068684

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTGS1 (NM_080591) Human Over-expression Lysate
LC403309 20 µg

PTGS1 (NM_080591) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Cap1 activation kit by CRISPRa
GA200510 1 Kit

Mouse Cap1 activation kit by CRISPRa

Sign In for Pricing
View Details
UBE2I Human Gene Knockout Kit (CRISPR)
KN401199 1 Kit

UBE2I Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TCP1 delta (CCT4) activation kit by CRISPRa
GA107234 1 Kit

Human TCP1 delta (CCT4) activation kit by CRISPRa

Sign In for Pricing
View Details
Sodium 2,3-Dimercaptopropanesulfonate Monohydrate
TRC-S083930-500MG 500 mg

Sodium 2,3-Dimercaptopropanesulfonate Monohydrate

Sign In for Pricing
View Details
-86°C ULT Freezer Upright BFUR-86-307
BFUR-86-307 1 Unit

-86°C ULT Freezer Upright BFUR-86-307

Sign In for Pricing
View Details