NXPH1, Rat (HEK293, His)
The NXPH1 protein is similar to a neuropeptide and acts as a signaling molecule by binding to alpha-neurotoxins.Its ligand action is suggested to mediate cell signaling through interactions with neuronal cell adhesion proteins.NXPH1 Protein, Rat (HEK293, His) is the recombinant rat-derived NXPH1 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
NXPH1 Protein, Rat (HEK293, His), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/nxph1-protein-rat-hek293-his.html
Purity
90.0
Smiles
ANLTNGGKSELLKSGNSKSTLKHIWTESSKDLSISRLLSQTFRGKENGTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG
Molecular Formula
25501 (Gene_ID) Q63366 (A22-G271) (Accession)
Molecular Weight
Approximately 43-55 kDa due to the glycosylation
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC434373 20 µg
Dystrobrevin alpha (DTNA) (NM_001198940) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC682338-500 1x 500 µL
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/2338R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC421516 20 µg
ZNFN1A2 (IKZF2) (NM_001079526) Human Over-expression Lysate
Sign In for Pricing
View Details 
