Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPH1, Rat (HEK293, His)

The NXPH1 protein is similar to a neuropeptide and acts as a signaling molecule by binding to alpha-neurotoxins.Its ligand action is suggested to mediate cell signaling through interactions with neuronal cell adhesion proteins.NXPH1 Protein, Rat (HEK293, His) is the recombinant rat-derived NXPH1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

NXPH1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nxph1-protein-rat-hek293-his.html

Purity

90.0

Smiles

ANLTNGGKSELLKSGNSKSTLKHIWTESSKDLSISRLLSQTFRGKENGTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG

Molecular Formula

25501 (Gene_ID) Q63366 (A22-G271) (Accession)

Molecular Weight

Approximately 43-55 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOMER3 (NM_001145721) Human Over-expression Lysate
LY428985 100 µg

HOMER3 (NM_001145721) Human Over-expression Lysate

Sign In for Pricing
View Details
D-Fructose-13C6
TRC-F792546-25MG 25 mg

D-Fructose-13C6

Sign In for Pricing
View Details
Rps27l Mouse Gene Knockout Kit (CRISPR)
KN515098 1 Kit

Rps27l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant ENO2 Antibody
RC-4534-01 50 μL

Recombinant ENO2 Antibody

Sign In for Pricing
View Details
Recombinant ENO2 Antibody
RC-4534-02 100 µL

Recombinant ENO2 Antibody

Sign In for Pricing
View Details
Recombinant ENO2 Antibody
RC-4534-03 1 mL

Recombinant ENO2 Antibody

Sign In for Pricing
View Details