Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPH1, Rat (HEK293, His)

The NXPH1 protein is similar to a neuropeptide and acts as a signaling molecule by binding to alpha-neurotoxins.Its ligand action is suggested to mediate cell signaling through interactions with neuronal cell adhesion proteins.NXPH1 Protein, Rat (HEK293, His) is the recombinant rat-derived NXPH1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

NXPH1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nxph1-protein-rat-hek293-his.html

Purity

90.0

Smiles

ANLTNGGKSELLKSGNSKSTLKHIWTESSKDLSISRLLSQTFRGKENGTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG

Molecular Formula

25501 (Gene_ID) Q63366 (A22-G271) (Accession)

Molecular Weight

Approximately 43-55 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS650702 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Human Lambda Light Chain (ICO-106), 1mg/mL
BNUM0019-50 1x 50 µL

Human Lambda Light Chain (ICO-106), 1mg/mL

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (M3A7), CF568 conjugate, 0.1mg/mL
BNC681827-100 1x 100 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (M3A7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GTF3C4 (N-term) Rabbit Polyclonal Antibody
AP54227PU-N 400 µL

GTF3C4 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
POFUT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A12]
TA504972AM 100 µL

POFUT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A12]

Sign In for Pricing
View Details
Phospho-EGFR Antibody (pS768)
F48553-0.4ML 0.4 mL

Phospho-EGFR Antibody (pS768)

Sign In for Pricing
View Details