Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPH1, Rat (HEK293, His)

The NXPH1 protein is similar to a neuropeptide and acts as a signaling molecule by binding to alpha-neurotoxins.Its ligand action is suggested to mediate cell signaling through interactions with neuronal cell adhesion proteins.NXPH1 Protein, Rat (HEK293, His) is the recombinant rat-derived NXPH1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

NXPH1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nxph1-protein-rat-hek293-his.html

Purity

90.0

Smiles

ANLTNGGKSELLKSGNSKSTLKHIWTESSKDLSISRLLSQTFRGKENGTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG

Molecular Formula

25501 (Gene_ID) Q63366 (A22-G271) (Accession)

Molecular Weight

Approximately 43-55 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ChT1 Rabbit Polyclonal Antibody
HA500314 100 µL

ChT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RhoB Polyclonal Antibody
E-AB-90414-01 60 µL

RhoB Polyclonal Antibody

Sign In for Pricing
View Details
RhoB Polyclonal Antibody
E-AB-90414-02 120 µL

RhoB Polyclonal Antibody

Sign In for Pricing
View Details
RhoB Polyclonal Antibody
E-AB-90414-03 200 µL

RhoB Polyclonal Antibody

Sign In for Pricing
View Details
Human TIGD7 activation kit by CRISPRa
GA114091 1 Kit

Human TIGD7 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Skin
CR561190 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details