Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPH1, Rat (HEK293, His)

The NXPH1 protein is similar to a neuropeptide and acts as a signaling molecule by binding to alpha-neurotoxins.Its ligand action is suggested to mediate cell signaling through interactions with neuronal cell adhesion proteins.NXPH1 Protein, Rat (HEK293, His) is the recombinant rat-derived NXPH1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

NXPH1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nxph1-protein-rat-hek293-his.html

Purity

90.0

Smiles

ANLTNGGKSELLKSGNSKSTLKHIWTESSKDLSISRLLSQTFRGKENGTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG

Molecular Formula

25501 (Gene_ID) Q63366 (A22-G271) (Accession)

Molecular Weight

Approximately 43-55 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SorLA Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-62077R-BF647 100 µL

SorLA Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Fyn Related Kinase (FRK) Antibody
abx033633-01 80 µL

Fyn Related Kinase (FRK) Antibody

Sign In for Pricing
View Details
Fyn Related Kinase (FRK) Antibody
abx033633-02 400 µL

Fyn Related Kinase (FRK) Antibody

Sign In for Pricing
View Details
Conivaptan HCl
A8402-5.1 10 mM (in 1mL DMSO)

Conivaptan HCl

Sign In for Pricing
View Details
Mouse Protein FAM49B, FAM49B ELISA Kit
MBS9320746-01 48 Well

Mouse Protein FAM49B, FAM49B ELISA Kit

Sign In for Pricing
View Details
Mouse Protein FAM49B, FAM49B ELISA Kit
MBS9320746-02 96 Well

Mouse Protein FAM49B, FAM49B ELISA Kit

Sign In for Pricing
View Details