Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tbx18 Rabbit Polyclonal Antibody (FITC)

Tbx18 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

2810012F10Rik, 2810404D13Rik

UniProt

Q9EPZ6

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SSETFAPPRTPSYVSVSSNPSVNMSMGGTDGDTFSCPQTSLSMQISGMSP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_076303

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CARD6 Protein Lysate (Rat) with C-HA Tag
15037036 100 µg

CARD6 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Polyclonal Grik4 Antibody
AMM05977G 0.1 mg

Polyclonal Grik4 Antibody

Sign In for Pricing
View Details
Human Lambda Light Chain (Lamb14), Biotin conjugate, 0.1mg/mL
BNCB0860-500 1x 500 µL

Human Lambda Light Chain (Lamb14), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PMS2 Antibody / Post Meiotic Segregation Increased 2
V5203-20UG 20 µg

PMS2 Antibody / Post Meiotic Segregation Increased 2

Sign In for Pricing
View Details
Rabbit Monoclonal DMP-1 Antibody (001) [Janelia Fluor 646]
NBP2-90020JF646 0.1 mL

Rabbit Monoclonal DMP-1 Antibody (001) [Janelia Fluor 646]

Sign In for Pricing
View Details
Alexa Fluor® 488 Mouse IgG2b, κ Isotype Ctrl
GT17055 100 Tests

Alexa Fluor® 488 Mouse IgG2b, κ Isotype Ctrl

Sign In for Pricing
View Details