Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aste1 Rabbit Polyclonal Antibody (Biotin)

Aste1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AV006403, 1100001A21Rik

UniProt

Q8BIR2

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YHRVLGLLNWLSHFDDPTEALDNVLKSLPKKSRENVKELLCCSMEEYQQS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_079927

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dock2 (Dedicator of Cytokinesis 2, AI662014, AW122239, CED-5, Dedicator of Cytokinesis Protein 2, Hch, MBC, Protein Hch)
D8080-20B 100 µg

Dock2 (Dedicator of Cytokinesis 2, AI662014, AW122239, CED-5, Dedicator of Cytokinesis Protein 2, Hch, MBC, Protein Hch)

Sign In for Pricing
View Details
Pack of 100 Technical Filter Discs 150G/M², 930 Mm
FT103A0930C Pack of 100

Pack of 100 Technical Filter Discs 150G/M², 930 Mm

Sign In for Pricing
View Details
FLIP Rabbit mAb
F0682-100uL*2 2x 100 μL

FLIP Rabbit mAb

Sign In for Pricing
View Details
FMO8P Protein Vector (Human) (pPM-C-His)
PV078624 500 ng

FMO8P Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
rno??miR-126 miRNA Inhibitor
MIR01065 2x 5.0 nmol

rno??miR-126 miRNA Inhibitor

Sign In for Pricing
View Details
Mouse Immune-responsive gene 1 protein homolog (IRG1) ELISA Kit
AE37814MO-01 48 Tests

Mouse Immune-responsive gene 1 protein homolog (IRG1) ELISA Kit

Sign In for Pricing
View Details