Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF7L Rabbit Polyclonal Antibody (Biotin)

TAF7L Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Taf2, Taf2q, 4933438I11Rik

UniProt

Q99MW7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse TAF7L

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EGKAERKKYNWKHGITPPLKNVRKKRFRKTTKKLPDVKQVDEINFSEYTQ

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_083234

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARK3 Mouse Monoclonal Antibody [Clone ID: OTI5E5]
CF805955 100 µg

MARK3 Mouse Monoclonal Antibody [Clone ID: OTI5E5]

Sign In for Pricing
View Details
PITRM1 (NM_014889) Human Recombinant Protein
TP310596M 100 µg

PITRM1 (NM_014889) Human Recombinant Protein

Sign In for Pricing
View Details
Cytochrome p450 2J2 (CYP2J2) (NM_000775) Human Recombinant Protein
TP307417L 1 mg

Cytochrome p450 2J2 (CYP2J2) (NM_000775) Human Recombinant Protein

Sign In for Pricing
View Details
UBE2L6 Mouse Monoclonal Antibody [Clone ID: k1H3]
AM09039PU-S 50 µL

UBE2L6 Mouse Monoclonal Antibody [Clone ID: k1H3]

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS508158 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
NSE (ENO2) (NM_001975) Human Over-expression Lysate
LY400724 100 µg

NSE (ENO2) (NM_001975) Human Over-expression Lysate

Sign In for Pricing
View Details