Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMX1A Rabbit Polyclonal Antibody (Biotin)

LMX1A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Dr, sst, Lmx1., Lmx1.1, dreher

UniProt

Q9JKU8

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AIEQSVYNSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGD

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_387501

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Poly-L-lysine Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS
MTB12F4-LYS-L 10x 96 Well Plates

Poly-L-lysine Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS

Sign In for Pricing
View Details
Recombinant Human CD16a/FCGR3A Protein (176 Val, His&AVI Tag), Biotinylated
PKSH030282-01 20 µg

Recombinant Human CD16a/FCGR3A Protein (176 Val, His&AVI Tag), Biotinylated

Sign In for Pricing
View Details
Recombinant Human CD16a/FCGR3A Protein (176 Val, His&AVI Tag), Biotinylated
PKSH030282-02 100 µg

Recombinant Human CD16a/FCGR3A Protein (176 Val, His&AVI Tag), Biotinylated

Sign In for Pricing
View Details
Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (IGHG4/2042R), CF405S conjugate, 0.1mg/mL
BNC042042-100 1x 100 µL

Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (IGHG4/2042R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2557R), CF594 conjugate, 0.1mg/mL
BNC942557-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2557R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD25/ IL2RA (Activated Lymphocyte Marker) (IL2RA/2395), 1mg/mL
BNUM2395-50 1x 50 µL

CD25/ IL2RA (Activated Lymphocyte Marker) (IL2RA/2395), 1mg/mL

Sign In for Pricing
View Details