Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMX1A Rabbit Polyclonal Antibody (Biotin)

LMX1A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Dr, sst, Lmx1., Lmx1.1, dreher

UniProt

Q9JKU8

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AIEQSVYNSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGD

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_387501

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ssxb8 Mouse Gene Knockout Kit (CRISPR)
KN516791 1 Kit

Ssxb8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DNA PKcs (PRKDC) Human Knockdown Lysate
LY300280 100 µg

DNA PKcs (PRKDC) Human Knockdown Lysate

Sign In for Pricing
View Details
D-Threonic Acid Calcium Salt
TRC-D234350-10MG 10 mg

D-Threonic Acid Calcium Salt

Sign In for Pricing
View Details
Retinol Binding Protein (RBP) Multi-Format ELISA Kit
K062-H1 1 Plate

Retinol Binding Protein (RBP) Multi-Format ELISA Kit

Sign In for Pricing
View Details
Tigd5 Mouse Gene Knockout Kit (CRISPR)
KN517566 1 Kit

Tigd5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Biotin (Hyb8), CF555 conjugate, 0.1mg/mL
BNC550400-100 1x 100 µL

Biotin (Hyb8), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details