Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMX1A Rabbit Polyclonal Antibody (HRP)

LMX1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Dr, sst, Lmx1., Lmx1.1, dreher

UniProt

Q9JKU8

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AIEQSVYNSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGD

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_387501

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Peroxiredoxin 5 (PRDX5) Antibody
abx101559-01 100 µL

Peroxiredoxin 5 (PRDX5) Antibody

Sign In for Pricing
View Details
Peroxiredoxin 5 (PRDX5) Antibody
abx101559-02 200 µL

Peroxiredoxin 5 (PRDX5) Antibody

Sign In for Pricing
View Details
Peroxiredoxin 5 (PRDX5) Antibody
abx101559-03 1 mL

Peroxiredoxin 5 (PRDX5) Antibody

Sign In for Pricing
View Details
NPPB Antibody
OAAJ07376-100UL 100 µL

NPPB Antibody

Sign In for Pricing
View Details
Recombinant Human Phosphoserine Phosphatase
BITP1416-01 5 µg

Recombinant Human Phosphoserine Phosphatase

Sign In for Pricing
View Details
Recombinant Human Phosphoserine Phosphatase
BITP1416-02 20 µg

Recombinant Human Phosphoserine Phosphatase

Sign In for Pricing
View Details