Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vgll2 Rabbit Polyclonal Antibody (HRP)

Vgll2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Vi, VIT, Vgl, Vito1, vgl-2, VITO-1, C130057C21Rik

UniProt

Q8BGW8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Vgll2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SELPFATDPYSPATLHGHLHQGAADWHHAHPHHAHPHHPYALGGALGAQA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_722481

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EPOR activation kit by CRISPRa
GA101436 1 Kit

Human EPOR activation kit by CRISPRa

Sign In for Pricing
View Details
CTNNB1 Antibody-C-terminal region
ARP97257_P050 100 µL

CTNNB1 Antibody-C-terminal region

Sign In for Pricing
View Details
HK2 Knockout A549 Polyclonal Cells
ARG23133 1 Million

HK2 Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details
Mouse Neutrophil cytosol factor 4, NCF4 ELISA Kit
MBS9337963-01 48 Well

Mouse Neutrophil cytosol factor 4, NCF4 ELISA Kit

Sign In for Pricing
View Details
Mouse Neutrophil cytosol factor 4, NCF4 ELISA Kit
MBS9337963-02 96 Well

Mouse Neutrophil cytosol factor 4, NCF4 ELISA Kit

Sign In for Pricing
View Details
Mouse Neutrophil cytosol factor 4, NCF4 ELISA Kit
MBS9337963-03 5x 96 Well

Mouse Neutrophil cytosol factor 4, NCF4 ELISA Kit

Sign In for Pricing
View Details