Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VDR Rabbit Polyclonal Antibody (FITC)

VDR Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NR1I1, PPP1R163

UniProt

P11473

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human VDR

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000367

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNTG1 Human siRNA Oligo Duplex (Locus ID 54212)
SR310049 1 Kit

SNTG1 Human siRNA Oligo Duplex (Locus ID 54212)

Sign In for Pricing
View Details
Recombinant Plasmodium Falciparum STI1-like Protein (aa 1-252)
VAng-Wyb6860-500gEcoli 500 µg (E. coli)

Recombinant Plasmodium Falciparum STI1-like Protein (aa 1-252)

Sign In for Pricing
View Details
Rat THAP domain-containing protein 4, THAP4 ELISA Kit
MBS9327027-01 48 Well

Rat THAP domain-containing protein 4, THAP4 ELISA Kit

Sign In for Pricing
View Details
Rat THAP domain-containing protein 4, THAP4 ELISA Kit
MBS9327027-02 96 Well

Rat THAP domain-containing protein 4, THAP4 ELISA Kit

Sign In for Pricing
View Details
Rat THAP domain-containing protein 4, THAP4 ELISA Kit
MBS9327027-03 5x 96 Well

Rat THAP domain-containing protein 4, THAP4 ELISA Kit

Sign In for Pricing
View Details
Rat THAP domain-containing protein 4, THAP4 ELISA Kit
MBS9327027-04 10x 96 Well

Rat THAP domain-containing protein 4, THAP4 ELISA Kit

Sign In for Pricing
View Details