Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM1 Rabbit Polyclonal Antibody (HRP)

PRDM1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BLIMP1, PRDI-BF1

UniProt

O75626

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PRDM1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRN

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

88kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001189

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHRNB1 Blocking Peptide
MBS9623897-01 1 mg

CHRNB1 Blocking Peptide

Sign In for Pricing
View Details
CHRNB1 Blocking Peptide
MBS9623897-02 5x 1 mg

CHRNB1 Blocking Peptide

Sign In for Pricing
View Details
TP53I3 (Tumor Protein p53 Inducible Protein 3, PIG3) (APC)
252909-APC 100 µL

TP53I3 (Tumor Protein p53 Inducible Protein 3, PIG3) (APC)

Sign In for Pricing
View Details
MAP3K5, CT (Mitogen-activated Protein Kinase Kinase Kinase 5, MAPKKK5, Apoptosis Signal-regulating Kinase 1, ASK1, ASK-1, MAPK/ERK Kinase Kinase 5, MEK Kinase 5, MEKK 5, MEKK5) (MaxLight 650)
M2867-52F-ML650 100 µL

MAP3K5, CT (Mitogen-activated Protein Kinase Kinase Kinase 5, MAPKKK5, Apoptosis Signal-regulating Kinase 1, ASK1, ASK-1, MAPK/ERK Kinase Kinase 5, MEK Kinase 5, MEKK 5, MEKK5) (MaxLight 650)

Sign In for Pricing
View Details
HAND1 Antibody
A42953-50UG 50 µg

HAND1 Antibody

Sign In for Pricing
View Details
Recombinant Sulfolobus tokodaii Leucine--tRNA ligase 2 (leuS2), partial
MBS1362592 Inquire

Recombinant Sulfolobus tokodaii Leucine--tRNA ligase 2 (leuS2), partial

Sign In for Pricing
View Details