Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ldb2 Rabbit Polyclonal Antibody (Biotin)

Ldb2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CLI, Ldb, CLIM, CLP-, Ldb3, CLIM-, CLIM1, CLP-36, AI035351, AW146358

UniProt

O55203

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLW

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034828

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMBR1, ID (LMBR1, C7orf2, DIF14, Limb region 1 protein homolog, Differentiation-related gene 14 protein) (MaxLight 650) discontinued
037830-ML650 100 µL

LMBR1, ID (LMBR1, C7orf2, DIF14, Limb region 1 protein homolog, Differentiation-related gene 14 protein) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Lentiviral human ZIC5 shRNA (UAS) - Lentiviral human ZIC5 shRNA (UAS) (100)
GTR15284394 1 Vial

Lentiviral human ZIC5 shRNA (UAS) - Lentiviral human ZIC5 shRNA (UAS) (100)

Sign In for Pricing
View Details
ELISA Kit for Gamma-synuclein (SNCG)
TRV-0063616-01 24 Tests

ELISA Kit for Gamma-synuclein (SNCG)

Sign In for Pricing
View Details
ELISA Kit for Gamma-synuclein (SNCG)
TRV-0063616-02 48 Tests

ELISA Kit for Gamma-synuclein (SNCG)

Sign In for Pricing
View Details
ELISA Kit for Gamma-synuclein (SNCG)
TRV-0063616-03 96 Tests

ELISA Kit for Gamma-synuclein (SNCG)

Sign In for Pricing
View Details
ELISA Kit for Gamma-synuclein (SNCG)
TRV-0063616-04 5x 96 Tests

ELISA Kit for Gamma-synuclein (SNCG)

Sign In for Pricing
View Details