Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EN1 Rabbit Polyclonal Antibody (HRP)

EN1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ENDOVESLB

UniProt

Q05925

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EN1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDES

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001417

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT18P25 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1172608 1.0 µg DNA

KRT18P25 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Vmn1r191-set siRNA/shRNA/RNAi Lentivector (Mouse)
49595094 4x 500 ng

Vmn1r191-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Recombinant Mouse CCL21/6Ckine Protein
NBP2-35179-1mg 1 mg

Recombinant Mouse CCL21/6Ckine Protein

Sign In for Pricing
View Details
Ptk6, NT (Ptk6, Sik, Protein-tyrosine kinase 6, SRC-related intestinal kinase) (MaxLight 550)
MBS6338828-01 0.1 mL

Ptk6, NT (Ptk6, Sik, Protein-tyrosine kinase 6, SRC-related intestinal kinase) (MaxLight 550)

Sign In for Pricing
View Details
Ptk6, NT (Ptk6, Sik, Protein-tyrosine kinase 6, SRC-related intestinal kinase) (MaxLight 550)
MBS6338828-02 5x 0.1 mL

Ptk6, NT (Ptk6, Sik, Protein-tyrosine kinase 6, SRC-related intestinal kinase) (MaxLight 550)

Sign In for Pricing
View Details
GDF7 (Growth Differentiation Factor 7, BMP12) (MaxLight 750)
MBS6238425-01 0.1 mL

GDF7 (Growth Differentiation Factor 7, BMP12) (MaxLight 750)

Sign In for Pricing
View Details