Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUNX1 Rabbit Polyclonal Antibody (HRP)

RUNX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AML1, CBFA2, EVI-1, AMLCR1, PEBP2aB, CBF2alpha, AML1-EVI-1, PEBP2alpha

UniProt

Q01196

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RUNX1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KMPAAPRGPAQGEAAARTRSRDASTSRRFTPPSTALSPGKMSEALPLGAP

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

AAC05247

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNGA2, NT (CNGA2, CNCA, CNCA1, CNCG2, Cyclic nucleotide-gated olfactory channel, Cyclic nucleotide-gated cation channel 2, Cyclic nucleotide-gated channel alpha-2) (Azide free) (HRP)
MBS6287145-01 0.2 mL

CNGA2, NT (CNGA2, CNCA, CNCA1, CNCG2, Cyclic nucleotide-gated olfactory channel, Cyclic nucleotide-gated cation channel 2, Cyclic nucleotide-gated channel alpha-2) (Azide free) (HRP)

Sign In for Pricing
View Details
CNGA2, NT (CNGA2, CNCA, CNCA1, CNCG2, Cyclic nucleotide-gated olfactory channel, Cyclic nucleotide-gated cation channel 2, Cyclic nucleotide-gated channel alpha-2) (Azide free) (HRP)
MBS6287145-02 5x 0.2 mL

CNGA2, NT (CNGA2, CNCA, CNCA1, CNCG2, Cyclic nucleotide-gated olfactory channel, Cyclic nucleotide-gated cation channel 2, Cyclic nucleotide-gated channel alpha-2) (Azide free) (HRP)

Sign In for Pricing
View Details
Biotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt
FB110183-01 1000 µg

Biotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt

Sign In for Pricing
View Details
Biotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt
FB110183-02 2000 µg

Biotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt

Sign In for Pricing
View Details
Biotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt
FB110183-03 5000 μg

Biotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt

Sign In for Pricing
View Details
Recombinant Human ISG15 / G1P2 Protein (mature form)
ARP5579-01 10 µg

Recombinant Human ISG15 / G1P2 Protein (mature form)

Sign In for Pricing
View Details