Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDX1 Rabbit Polyclonal Antibody (FITC)

CDX1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MGC116915

UniProt

P47902

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CDX1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GPPAPPPAPPQYPDFSSYSHVEPAPAPPTAWGAPFPAPKDDWAAAYGPGP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001795

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AF647 Anti-Human CD16 Antibody
JOT22730F 20Tests

AF647 Anti-Human CD16 Antibody

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Probable WRKY transcription factor 49 (WRKY49)
MBS1478646-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Probable WRKY transcription factor 49 (WRKY49)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Probable WRKY transcription factor 49 (WRKY49)
MBS1478646-02 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Probable WRKY transcription factor 49 (WRKY49)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Probable WRKY transcription factor 49 (WRKY49)
MBS1478646-03 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Probable WRKY transcription factor 49 (WRKY49)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Probable WRKY transcription factor 49 (WRKY49)
MBS1478646-04 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana Probable WRKY transcription factor 49 (WRKY49)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Probable WRKY transcription factor 49 (WRKY49)
MBS1478646-05 0.02 mg (Baculovirus)

Recombinant Arabidopsis thaliana Probable WRKY transcription factor 49 (WRKY49)

Sign In for Pricing
View Details