Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdx1 Rabbit Polyclonal Antibody (HRP)

Cdx1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cdx, Cdx-1

UniProt

P18111

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ERQVKIWFQNRRAKERKVNKKKQQQQQPLPPTQLPLPLDGTPTPSGPPLG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034010

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Desmocollin-2 (DSC2), partial
orb3010066-01 20 µg

Recombinant Human Desmocollin-2 (DSC2), partial

Sign In for Pricing
View Details
Recombinant Human Desmocollin-2 (DSC2), partial
orb3010066-02 100 µg

Recombinant Human Desmocollin-2 (DSC2), partial

Sign In for Pricing
View Details
Recombinant Human Desmocollin-2 (DSC2), partial
orb3010066-03 1 mg

Recombinant Human Desmocollin-2 (DSC2), partial

Sign In for Pricing
View Details
Lentiviral human EIF2B3 shRNA (UAS) - Lentiviral human EIF2B3 shRNA (UAS, GFP) plasmid
GTR15152362 1 Vial

Lentiviral human EIF2B3 shRNA (UAS) - Lentiviral human EIF2B3 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Anti-Cxcr3 Antibody Picoband®, APC Conjugate
A00295-2-APC 100 µg/Vial

Anti-Cxcr3 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
Human antineutrophil cytoplasmic antibodies (ANCA) ELISA Kit
CK-bio-27633-01 48 Tests

Human antineutrophil cytoplasmic antibodies (ANCA) ELISA Kit

Sign In for Pricing
View Details